PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011099269.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family TALE
Protein Properties Length: 765aa    MW: 82913.1 Da    PI: 7.2633
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011099269.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.52.7e-095676041954
                     HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     Fe   ++yps +++  LA+++gL+ +qV++WF N R +
  XP_011099269.1 567 FEHflHPYPSDADKHLLARQTGLSRNQVSNWFINARVR 604
                     664459******************************88 PP

2BELL121.83e-39429499272
            BELL   2 rqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                     r e+q++k+kLls+l+eVd+rY++y+eq+q+v++sF++v+g g+a pYt lA+ka+SrhFrcLkdaia q+
  XP_011099269.1 429 RLEHQRRKVKLLSMLDEVDRRYNHYCEQMQMVVNSFDMVMGFGAAVPYTCLAQKAMSRHFRCLKDAIAAQL 499
                     779*****************************************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005742.7E-80350497IPR006563POX domain
PfamPF075262.8E-53355496IPR006563POX domain
PROSITE profilePS5007112.568545608IPR001356Homeobox domain
CDDcd000864.28E-13548609No hitNo description
SMARTSM003891.2E-9548612IPR001356Homeobox domain
SuperFamilySSF466892.99E-17550615IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.2E-29551614IPR009057Homeodomain-like
PfamPF059203.9E-18565604IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009965Biological Processleaf morphogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 765 aa     Download sequence    Send to blast
MDMGIATPTL LPSVTSHSKG HNSLQYLDKQ NFSNSMSQDY HQSIFSFSNG FERSQQEQQQ  60
QHIAQQIRRD KLRVQGFQPP VPPLVGIEGE ESGELPVYET AGMLSEMFNF PSGVAATATE  120
LLENQILQSY RNPRGTPPSG GASTADWFPH RQGMVVGGAN LGDSKNQTVV NDTASHPHHQ  180
QQQHQISSIN ADSAAAMQLF LMNPQQQRSP SPSPSHPPPS TSSTLHMLLP NPSSSSTLQA  240
FQNPSAGAFG QFTWVPNSGN ENNPNEIPGV VEGQGLSLSL SSSLQHLEAA KAEELRMGEG  300
GMLFFGQGGG STPPQYQFKN FGGSGGGALH LQGGGVSHNH QLHVGLGSSL GTVNMLRNSK  360
YAKAAQELLE EFCSVGRGQF KKNKFGKQNN NNGNPSSNPS AGATSGGGAG GGNSSSSSKD  420
NPPLSAADRL EHQRRKVKLL SMLDEVDRRY NHYCEQMQMV VNSFDMVMGF GAAVPYTCLA  480
QKAMSRHFRC LKDAIAAQLK HSCELLGEKD AGTSGVTKGE TPRLRILEQS LRQQRAFHQM  540
GMMDQEAWRP QRGLPERSVN ILRAWLFEHF LHPYPSDADK HLLARQTGLS RNQVSNWFIN  600
ARVRLWKPMV EEMYQQEAKD EAASTEQDRD QSSTSAQTPT LNANPPATTT TTATSATAIT  660
PSPAKRSEIN APENDPSFVA INNNQCFSDN QPKLHHHSTA NVSLPPAPAV AQSFSVVHPS  720
NDGIHESTLI RFGTNAGDVS LTLGLRHAGN LPEKSPFSVR DFGGC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A2e-16554612563Homeobox protein Meis2
3k2a_B2e-16554612563Homeobox protein Meis2
4xrm_A2e-16554612563Homeobox protein Meis2
4xrm_B2e-16554612563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011099269.10.0PREDICTED: BEL1-like homeodomain protein 4
SwissprotQ9SW801e-177BLH2_ARATH; BEL1-like homeodomain protein 2
TrEMBLA0A022RUY30.0A0A022RUY3_ERYGU; Uncharacterized protein
STRINGVIT_04s0023g01020.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA33412139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36870.21e-143BEL1-like homeodomain 2